General Information

  • ID:  hor004541
  • Uniprot ID:  P60042
  • Protein name:  Antrin
  • Gene name:  SST
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Somatostatin family
  • Source:  animal
  • Expression:  Somatostatin is detected in neurons throughout the brain, including in the lateral septum, nucleus accumbens, amygdaloid complex, hypothalamic periventricular nucleus, hippocampus, cortex, cerebellum and several brainstem nuclei (at protein level) .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0048018 receptor ligand activity
  • GO BP:  GO:0006972 hyperosmotic response; GO:0009410 response to xenobiotic stimulus; GO:0010243 response to organonitrogen compound; GO:0010447 response to acidic pH; GO:0030334 regulation of cell migration; GO:0038170 somatostatin signaling pathway; GO:0043200 response to amino acid; GO:0048545 response to steroid hormone; GO:0099072 regulation of postsynaptic membrane neurotransmitter receptor levels
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043025 neuronal cell body; GO:0098982 GABA-ergic synapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  LRQFLQKSLAAAT
  • Length:  13(31-43)
  • Propeptide:  MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEPNQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
  • Signal peptide:  MLSCRLQCALAALCIVLALGGVTG
  • Modification:  T13 Threonine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May enhance low-glucose-induced glucagon release by pancreatic alpha cells. This effect may be mediated by binding to GPR107 and PKA activation. May regulate cardiac contractile function. May compromise cardiomyocyte viability. In the central nervous syst
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Sstr2, Sstr3
  • Target Unid:  P30680, P30936
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P60042-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004541_AF2.pdbhor004541_ESM.pdb

Physical Information

Mass: 166095 Formula: C65H111N19O18
Absent amino acids: CDEGHIMNPVWY Common amino acids: AL
pI: 11.65 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 7
Hydrophobicity: 20.77 Boman Index: -1435
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 113.08
Instability Index: 5813.85 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18753129
  • Title:  Neuronostatin Encoded by the Somatostatin Gene Regulates Neuronal, Cardiovascular, and Metabolic Functions